Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS |
Goat Anti-GM2A (aa 164-175) Antibody
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TTGNYRIESVLS, from the internal region of the protein sequence according to NP_000396.2. |
Rabbit Polyclonal Anti-GM2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GM2A antibody: synthetic peptide directed towards the N terminal of human GM2A. Synthetic peptide located within the following region: SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL |
Germany
Japan
United Kingdom
China