Germany
Japan
United Kingdom
China
TFDP2 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
TFDP2 mouse monoclonal antibody,clone OTI7B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFDP2 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFDP2 mouse monoclonal antibody,clone OTI7B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TFDP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF |
TFDP2 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-TFDP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TFDP2 antibody is: synthetic peptide directed towards the C-terminal region of Human TFDP2. Synthetic peptide located within the following region: SVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDE |
TFDP2 mouse monoclonal antibody,clone OTI7B6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
- Antibodies
Target Symbol
- DP2
Reactivities
- Human
Applications
- WB
Conjugates
- Unconjugated
Pathways
- Cell cycle