Germany
Japan
United Kingdom
China
DHFR / DHFRP1 mouse monoclonal antibody, clone AT5B2, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit anti-DHFR Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DHFR |
Rabbit Polyclonal Anti-GCH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT |
Folylpolyglutamate synthase (FPGS) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human FPGS |
GGH rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SPR (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 232-261aa) of human Sepiapterin reductase / SPR. |
Carrier-free (BSA/glycerol-free) ALPL mouse monoclonal antibody,clone OTI3A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Alkaline Phosphatase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Alkaline Phosphatase [Human Intestine] |
Rabbit polyclonal Alkaline Phosphatase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Alkaline Phosphatase [Human Intestine] |
Rabbit Polyclonal anti-ALPPL2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2. Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT |
Rabbit Polyclonal anti-ALPPL2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the middle region of human ALPPL2. Synthetic peptide located within the following region: SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV |
Rabbit anti-QDPR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human QDPR |
Rabbit Polyclonal Anti-GCH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR |
QDPR Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human QDPR |
ALPL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ALPL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Conjugates
- Unconjugated
Pathways
- Folate biosynthesis