Germany
Japan
United Kingdom
China
Antibodies
View as table Download
HDAC3 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 330 to the C-terminus of human HDAC3 (NP_003874.2). |
| Modifications | Unmodified |
Rabbit anti-HDAC3 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC3 |
Anti-HDAC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 414-428 amino acids of Human histone deacetylase 3 |
Rabbit Polyclonal HDAC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC3 |
Rabbit Polyclonal HDAC3 (Ser424) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC3 around the phosphorylation site of Serine 424 |
| Modifications | Phospho-specific |
Anti-HDAC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 414-428 amino acids of Human histone deacetylase 3 |
Rabbit Polyclonal anti-Hdac3 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hdac3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Rabbit Polyclonal Anti-HDAC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC3 Antibody: A synthesized peptide derived from human HDAC3 |
HDAC3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HDAC3 |
| Modifications | Unmodified |
Rabbit monoclonal to human HDAC3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Target Symbol
- HDAC3
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated