Rabbit Polyclonal Anti-PIWIL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR |
PIWIL4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human PIWIL4 (NP_689644.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-PIWIL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS |
Germany
Japan
United Kingdom
China