Antibodies

View as table Download

Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Pig, Chimpanzee)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401)

Rabbit polyclonal PGR/PR Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PGR/PR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 816-843 amino acids from the C-terminal region of human PGR/PR.

Rabbit anti Progesterone Receptor (PR) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of human Progesterone receptor. This sequence is identical within human, mouse, rat, chicken, bovine and dog origins.

Rabbit Polyclonal Progesterone Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor

Rabbit Polyclonal Progesterone Receptor (Ser294) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 294
Modifications Phospho-specific

Rabbit Polyclonal Progesterone Receptor (Ser400) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Progesterone Receptor around the phosphorylation site of Serine 400
Modifications Phospho-specific

Rabbit Polyclonal anti-PR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PR antibody is: synthetic peptide directed towards the N-terminal region of Human PR. Synthetic peptide located within the following region: LPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAG