Antibodies

Jump to Filters
View as table Download
NEK11 Rabbit Polyclonal Antibody
TA346831

USD 539.00

5 Days

Rabbit Polyclonal Anti-NEK11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11. Synthetic peptide located within the following region: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMS
NEK11 Rabbit Polyclonal Antibody
TA349609

USD 380.00

In Stock

Rabbit Polyclonal Anti-NEK11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NEK11