Germany
Japan
United Kingdom
China
ZFP42 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
ZFP42 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZFP42 mouse monoclonal antibody, clone OTI12A7 (formerly 12A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZFP42 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZFP42 mouse monoclonal antibody, clone OTI12A7 (formerly 12A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the N terminal of human ZFP42. Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ZFP42 |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: QKVFEASSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGI |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEG |
Rabbit Polyclonal Anti-Rex1(ZFP42) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rex1(ZFP42) Antibody: Peptide sequence around aa.10~14(K-T-R-H-Q) derived from Human Rex1(ZFP42). |
ZFP42 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ZFP42 mouse monoclonal antibody, clone OTI9E8 (formerly 9E8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
- Antibodies
Target Symbol
- REX1
Reactivities
- Human
Applications
- WB
Conjugates
- Unconjugated
Families
- Embryonic stem cells