Antibodies

Jump to Filters
View as table Download
FOXA3 Rabbit Polyclonal Antibody
TA329710

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOXA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3. Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
FOXA3 Rabbit Polyclonal Antibody
TA341776

USD 539.00

5 Days

Rabbit Polyclonal Anti-Foxa3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxa3 antibody: synthetic peptide directed towards the c terminal of mouse Foxa3. Synthetic peptide located within the following region: YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLL