Rabbit polyclonal antibody to EML1 (echinoderm microtubule associated protein like 1)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Zebrafish) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 753 and 815 of EML1 (Uniprot ID#O00423) |
Rabbit Polyclonal Anti-EML1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EML1 antibody: synthetic peptide directed towards the C terminal of human EML1. Synthetic peptide located within the following region: YPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI |
Germany
Japan
United Kingdom
China
