Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 204 of TC21 (Uniprot ID#P62070) |
Rabbit Polyclonal Anti-RRAS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RRAS2 |
Rabbit Polyclonal RRAS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal RRAS2 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human RRAS2. |
Rabbit Polyclonal Anti-RRAS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RRAS2 antibody is: synthetic peptide directed towards the C-terminal region of Human RRAS2. Synthetic peptide located within the following region: EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF |
Germany
Japan
United Kingdom
China
