Antibodies

Jump to Filters
View as table Download
BDKRB1 Goat Polyclonal Antibody
TA302436

USD 520.00

In Stock

Goat Polyclonal Antibody against Bradykinin receptor B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2.
BDKRB1 Rabbit Polyclonal Antibody
TA311799

USD 380.00

In Stock

Rabbit polyclonal anti-BDKRB1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BDKRB1.
Modifications Phospho-specific
BDKRB1 Rabbit Polyclonal Antibody
TA338374

USD 539.00

5 Days

Rabbit Polyclonal Anti-BDKRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ
BDKRB1 (Center) Rabbit Polyclonal Antibody
AP17901PU-N

USD 580.00

2 Weeks

BDKRB1 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human BDKRB1
BDKRB1 Rabbit Polyclonal Antibody
TA358861

USD 539.00

5 Days

BDKRB1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated