Antibodies

Jump to Filters
View as table Download
GCLC (N-term) Rabbit Polyclonal Antibody
AP51800PU-N

USD 580.00

2 Weeks

GCLC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 6-34 amino acids from the N-terminal region of Human GCLC / GLCLC
GCLC Rabbit Polyclonal Antibody
TA335009

USD 539.00

5 Days

Rabbit Polyclonal Anti-GCLC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLC antibody: synthetic peptide directed towards the N terminal of human GCLC. Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
GCLC Rabbit Polyclonal Antibody
TA335010

USD 539.00

5 Days

Rabbit Polyclonal Anti-GCLC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLC antibody: synthetic peptide directed towards the middle region of human GCLC. Synthetic peptide located within the following region: RISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQEGIDHLLAQHVA