Antibodies

Jump to Filters
View as table Download
SPIRE2 Rabbit Polyclonal Antibody
TA342930

USD 539.00

5 Days

Rabbit Polyclonal Anti-SPIRE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG
SPIRE2 Rabbit Polyclonal Antibody
TA381948

USD 365.00

3 Weeks

SPIRE2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human SPIRE2 (NP_115827.1).
Modifications Unmodified