Antibodies

Jump to Filters
View as table Download
KLHL9 Rabbit Polyclonal Antibody
TA350121

USD 380.00

In Stock

Rabbit Polyclonal Anti-KLHL9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KLHL9
KLHL9 Rabbit Polyclonal Antibody
TA344835

USD 539.00

5 Days

Rabbit Polyclonal Anti-KLHL9 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLHL9 antibody: synthetic peptide directed towards the middle region of human KLHL9. Synthetic peptide located within the following region: SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY