Antibodies

Jump to Filters
View as table Download
PEN2 (PSENEN) Rabbit Polyclonal Antibody
TA306368

USD 570.00

5 Days

Rabbit Polyclonal PEN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2.
PEN2 (PSENEN) Rabbit Polyclonal Antibody
TA306367

USD 570.00

5 Days

Rabbit Polyclonal PEN2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2.
PEN2 (PSENEN) Rabbit Polyclonal Antibody
TA342614

USD 539.00

5 Days

Rabbit Polyclonal Anti-PSENEN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT