Antibodies

Jump to Filters
View as table Download
AP2B1 Rabbit Polyclonal Antibody
TA332492

USD 365.00

3 Weeks

Rabbit anti-AP2B1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AP2B1
AP2B1 Rabbit Polyclonal Antibody
TA336045

USD 539.00

5 Days

Rabbit Polyclonal Anti-AP2B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP
AP2B1 Rabbit Polyclonal Antibody
TA336046

USD 539.00

5 Days

Rabbit Polyclonal Anti-AP2B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the C terminal of human AP2B1. Synthetic peptide located within the following region: GAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV
AP2B1 Rabbit Polyclonal Antibody
TA336047

USD 539.00

5 Days

Rabbit Polyclonal Anti-AP2B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI