Antibodies

Jump to Filters
View as table Download
TSG101 Rabbit Polyclonal Antibody
TA343598

USD 485.00

5 Days

Rabbit Polyclonal Anti-TSG101 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TSG101 antibody: synthetic peptide directed towards the C terminal of human TSG101. Synthetic peptide located within the following region: TIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
TSG101 Rabbit Polyclonal Antibody
TA312310

USD 380.00

In Stock

Rabbit polyclonal anti-TSG101 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TS101.