Antibodies

Jump to Filters
View as table Download
IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody
TA337646

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL13RA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the N terminal of human IL13RA2. Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
IL13 receptor alpha 2 (IL13RA2) Rabbit Polyclonal Antibody
TA336224

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL13RA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP