Antibodies

View as table Download

Rabbit polyclonal anti-CDKL1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDKL1.

Rabbit Polyclonal Anti-CDKL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDKL1 Antibody is: synthetic peptide directed towards the N-terminal region of Human CDKL1. Synthetic peptide located within the following region: EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALRE