Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF |
Goat Polyclonal Antibody against VDAC2 (C Terminus)
| Applications | IHC, PEP-ELISA, WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GHKVGLALELEA, from the C Terminus of the protein sequence according to NP_003366.2. |
VDAC1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VDAC1 |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
Rabbit polyclonal VDAC/Porin antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | VDAC/Porin Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 185-197 of Human VDAC1/Porin1. |
VDAC1 (N-term) rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VDAC1. |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-VDAC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Goat Polyclonal Antibody against VDAC2 (Internal)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DSAKSKLTRNN, from the internal region of the protein sequence according to NP_003366.2. |
Rabbit Polyclonal VDAC2/3 Antibody
| Applications | WB |
| Reactivities | Human, Bovine, Canine, Feline, Primate |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 120-132 (KKSGKIKSSYKRE) of human VDAC2 protein were used as the immunogen. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Applications
- WB
Clonalities
- Polyclonal
Families
- Ion Channels: Other
Pathways
- Huntington's disease