Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the N terminal of human ZFP42. Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ZFP42 |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: QKVFEASSLECSLEYMKKGVKKELPQKIVGENSLEYSEYMTGKKLPPGGI |
Rabbit Polyclonal Anti-ZFP42 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the middle region of human ZFP42. Synthetic peptide located within the following region: FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNKNEQEG |
Rabbit Polyclonal Anti-Rex1(ZFP42) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rex1(ZFP42) Antibody: Peptide sequence around aa.10~14(K-T-R-H-Q) derived from Human Rex1(ZFP42). |
Germany
Japan
United Kingdom
China
