Rabbit Polyclonal antibody to SUOX (sulfite oxidase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 291 of SUOX (Uniprot ID#P51687) |
Rabbit Polyclonal Anti-PAPSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
Germany
Japan
United Kingdom
China
