Rabbit polyclonal antibody to FMO2 (flavin containing monooxygenase 2 (non-functional))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 74 and 354 of FMO2 (Uniprot ID#Q99518) |
Rabbit Polyclonal Anti-FMO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FMO2 antibody: synthetic peptide directed towards the N terminal of human FMO2. Synthetic peptide located within the following region: KYIQFQTTVLSVRKCPDFSSSGQWKVVTQSNGKEQSAVFDAVMVCSGHHI |
Germany
Japan
United Kingdom
China
