Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 17 results

Page 1 of 2

(reset)

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI4F12]

TA502777

USD 447.00

In Stock

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI1C10]

TA506126

USD 447.00

In Stock

ACAA2 mouse monoclonal antibody, clone OTI1C10 (formerly 1C10)

Applications	IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ACAT2 Mouse Monoclonal Antibody [Clone ID: OTI3E2]

TA501222

USD 447.00

In Stock

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Aldehyde dehydrogenase 10 (ALDH3A2) Rabbit Polyclonal Antibody

TA590756

USD 482.00

In Stock

Rabbit Polyclonal FALDH Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

ADH1B Mouse Monoclonal Antibody [Clone ID: OTI4F12]

TA502777S

USD 200.00

In Stock

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACAA2 Mouse Monoclonal Antibody [Clone ID: OTI1C10]

TA506126S

USD 200.00

In Stock

ACAA2 mouse monoclonal antibody, clone OTI1C10 (formerly 1C10)

Applications	IF, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ADH5 Rabbit Polyclonal Antibody

TA327239

USD 365.00

3 Weeks

Rabbit anti-ADH5 Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ADH5

1 / 3

2 / 3

3 / 3

Previous Next

ACADS Rabbit Polyclonal Antibody

TA321036

USD 380.00

2 Weeks

Anti-ACADS rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 250 amino acids of human acyl-CoA dehydrogenase, C-2 to C-3 short chain

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ACAA2 Rabbit Polyclonal Antibody

TA321746

USD 380.00

4 Weeks

Anti-ACAA2 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 250 amino acids of human acetyl-CoA acyltransferase 2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ALDH2 Mouse Monoclonal Antibody [Clone ID: 138CT22.3.8]

TA324332

USD 580.00

2 Weeks

Mouse monoclonal ALDH2 Antibody

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACSL3 Rabbit Polyclonal Antibody

TA339415

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

1 / 3

2 / 3

3 / 3

Previous Next

FACL4 (ACSL4) Rabbit Polyclonal Antibody

TA324720

USD 580.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).

1 / 3

2 / 3

3 / 3

Previous Next

CPT1A Goat Polyclonal Antibody

TA303144

USD 520.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.

1 / 2

2 / 2

Previous Next

ACAT1 Mouse Monoclonal Antibody [Clone ID: AT15E5]

AM50027PU-N

USD 430.00

3 Weeks

ACAT1 mouse monoclonal antibody, clone AT15E5, Purified

Applications	ELISA, WB
Reactivities	Human
Conjugation	Unconjugated

ALDH7A1 Rabbit Polyclonal Antibody

TA344576

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

1 - 15 of 17 results

Page 1 of 2