Antibodies

Jump to Filters
View as table Download
Cytochrome p450 2J2 (CYP2J2) (N-term) Rabbit Polyclonal Antibody
AP17970PU-N

USD 580.00

2 Weeks

Cytochrome p450 2J2 (CYP2J2) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CYP2J2
LTC4S Rabbit Polyclonal Antibody
TA330968

USD 539.00

2 Weeks

Rabbit polyclonal Anti-LTC4S Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY