Antibodies

Jump to Filters
View as table Download
Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody
TA324142

USD 380.00

In Stock

Anti-CYP3A4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4
Cytochrome P450 3A4 (CYP3A4) Rabbit Polyclonal Antibody
TA324141

USD 380.00

In Stock

Anti-CYP3A4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4
Cytochrome P450 1A2 (CYP1A2) Rabbit Polyclonal Antibody
TA351484

USD 380.00

In Stock

Rabbit Polyclonal Anti-CYP1A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP1A2
Cytochrome P450 2E1 (CYP2E1) Rabbit Polyclonal Antibody
TA346049

USD 539.00

In Stock

Rabbit Polyclonal Anti-CYP2E1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL
CYP3A7 Rabbit Polyclonal Antibody
TA313720

USD 380.00

In Stock

Rabbit polyclonal Cytochrome P450 3A7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7.