Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit polyclonal Cytochrome P450 2A6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 2A6. |
Rabbit polyclonal anti-CYP2A7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP2A7. |
Rabbit polyclonal Cytochrome P450 3A7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 3A7. |
Rabbit polyclonal Cytochrome P450 2A13 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2A13. |
Rabbit polyclonal Cytochrome P450 2D6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2D6. |
Rabbit polyclonal anti-CYP2D6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CYP2D6. |
Rabbit polyclonal anti-CYP2D6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP2D6. |
USD 380.00
In Stock
Rabbit polyclonal anti-MGST1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST1. |
Active filters
Applications
- WB
Isotypes
- IgG
Families
- Transmembrane
Pathways
- Drug metabolism - cytochrome P450
Availabilities
- In Stock