Antibodies

Jump to Filters
View as table Download
HNRPM (HNRNPM) Rabbit Polyclonal Antibody
TA351937

USD 380.00

In Stock

Rabbit Polyclonal Anti-HNRNPM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPM
hnRNP U (HNRNPU) Rabbit Polyclonal Antibody
TA345875

USD 539.00

In Stock

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
NCBP2 Rabbit Polyclonal Antibody
TA315201

USD 380.00

In Stock

Rabbit polyclonal anti-NCBP2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCBP2.