Antibodies

View as table Download

Rabbit Polyclonal Anti-CALB1 Antibody

Applications IHC, WB
Reactivities Human, Tadpole
Conjugation Unconjugated
Immunogen The immunogen for anti-CALB1 antibody: synthetic peptide directed towards the C terminal of human CALB1. Synthetic peptide located within the following region: EFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIM

Rabbit Polyclonal Anti-CALB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CALB1