Antibodies

Jump to Filters
View as table Download
PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA506857

USD 447.00

In Stock

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF506857

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PPAP2A (PLPP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA506857AM

USD 509.00

2 Weeks

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322829

USD 380.00

In Stock

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PPAP2A (PLPP1) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA506857S

USD 200.00

2 Days

PPAP2A mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA329515

USD 485.00

5 Days

Rabbit Polyclonal anti-PPAP2A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA346363

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL