Goat Anti-HIP14L / ZDHHC13 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-FHPAREKVLRSV, from the C Terminus of the protein sequence according to NP_061901.2; NP_001001483.1. |
Rabbit Polyclonal Anti-ZDHHC13 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZDHHC13 antibody: synthetic peptide directed towards the N terminal of human ZDHHC13. Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV |
Germany
Japan
United Kingdom
China
