PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PCBP1 mouse monoclonal antibody, clone OTI3D12 (formerly 3D12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-PCBP1 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF |
PCBP1 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
hnRNP E1/PCBP1 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human hnRNP E1/hnRNP E1/PCBP1 (NP_006187.2). |
Modifications | Unmodified |