USD 447.00
In Stock
KARS mouse monoclonal antibody,clone OTI1E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
KARS mouse monoclonal antibody,clone OTI1E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) KARS mouse monoclonal antibody,clone OTI1E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
KARS mouse monoclonal antibody,clone OTI1E7, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
KARS mouse monoclonal antibody,clone OTI1E7, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 200.00
2 Days
KARS mouse monoclonal antibody,clone OTI1E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-KARS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KARS |
Rabbit Polyclonal Anti-KARS Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV |