Rabbit Polyclonal Anti-SLC1A5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC1A5 antibody: synthetic peptide directed towards the middle region of human SLC1A5. Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV |
SLC1A5 / ASCT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC1A5. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
SLC1A5 / ASCT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Gibbon (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC1A5. Percent identity with other species by BLAST analysis: Human, Gibbon, Marmoset (100%); Monkey (94%); Dog, Horse (82%). |
SLC1A5 / ASCT2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey, Rat) |
| Conjugation | Unconjugated |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human SLC1A5. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey, Rat (93%); Marmoset, Hamster, Elephant, Horse (87%); Mouse, Bat, Bovine (80%). |
Germany
Japan
United Kingdom
China
