Antibodies

Jump to Filters
View as table Download
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA345790

USD 485.00

5 Days

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the N terminal of human HNRPA1. Synthetic peptide located within the following region: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA314018

USD 380.00

4 Weeks

Rabbit polyclonal anti-hnRNP A1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from inetrnal of human hnRNP A1.
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
TA345791

USD 485.00

5 Days

Rabbit Polyclonal Anti-HNRPA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRPA1 antibody: synthetic peptide directed towards the C terminal of human HNRPA1. Synthetic peptide located within the following region: NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG
hnRNP A1 (HNRNPA1) Rabbit Polyclonal Antibody
AP20408PU-N

USD 465.00

3 Weeks

hnRNP A1 (HNRNPA1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated