Antibodies

View as table Download

THOC3 mouse monoclonal antibody,clone OTI4H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) THOC3 mouse monoclonal antibody,clone OTI4H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

THOC3 mouse monoclonal antibody,clone OTI4H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-THOC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3. Synthetic peptide located within the following region: PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLT