Antibodies

Jump to Filters
View as table Download
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]
TA503125

USD 447.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF503125

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated
LCMT1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C9]
TA503125AM

USD 509.00

2 Weeks

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Biotin
LCMT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]
TA503125BM

USD 509.00

2 Weeks

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation HRP
LCMT1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]
TA503125S

USD 200.00

In Stock

LCMT1 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SRD5A2 Rabbit Polyclonal Antibody
TA335223

USD 539.00

5 Days

Rabbit Polyclonal Anti-SRD5A2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
CYP11B1 Rabbit Polyclonal Antibody
TA342857

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP11B1 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
SRD5A1 (173-184) Goat Polyclonal Antibody
AP23129PU-N

USD 555.00

2 Weeks

SRD5A1 (173-184) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide from internal region of human SRD5A1 (NP_001038.1)
Aromatase (CYP19A1) Rabbit Polyclonal Antibody
TA301409

USD 550.00

In Stock

Rabbit Polyclonal Antibody against Aromatase

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human aromatase protein sequence (between residues 400-502).
HSD3B2 Rabbit Polyclonal Antibody
TA334658

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSD3B2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD3B2 antibody: synthetic peptide directed towards the N terminal of human HSD3B2. Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN