Antibodies

View as table Download

FABP3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FABP3

FABP3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FABP3

Anti-FABP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-108 amino acids of Human Fatty acid-binding protein 3

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV

Rabbit Polyclonal Anti-FABP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG

FABP3 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human FABP3 (NP_004093.1).
Modifications Unmodified