Antibodies

Jump to Filters
View as table Download
SUV39H1 Rabbit Polyclonal Antibody
TA330558

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-SUV39H1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUV39H1 antibody: synthetic peptide directed towards the C terminal of human SUV39H1. Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
SUV39H1 Rabbit Polyclonal Antibody
TA382221

USD 365.00

3 Weeks

SUV39H1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SUV39H1 (NP_003164.1).
Modifications Unmodified