SOAT2 mouse monoclonal antibody,clone OTI2D3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
SOAT2 mouse monoclonal antibody,clone OTI2D3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SOAT2 mouse monoclonal antibody,clone OTI2D3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
SOAT2 mouse monoclonal antibody,clone 2D3, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
SOAT2 mouse monoclonal antibody,clone 2D3, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
SOAT2 mouse monoclonal antibody,clone OTI2E12
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SOAT2 mouse monoclonal antibody,clone OTI2E12
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
SOAT2 mouse monoclonal antibody,clone 2E12, Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
5 Days
SOAT2 mouse monoclonal antibody,clone 2E12, HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DHCR24 |
Rabbit Polyclonal Anti-TM7SF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TM7SF2 |
SOAT2 mouse monoclonal antibody,clone OTI2D3
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-DHCR7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DHCR7 |
Rabbit Polyclonal Anti-MSMO1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MSMO1 |
Rabbit Polyclonal Anti-SQLE Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Squalene Epoxidase (SQLE) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 67-97aa) of human Squalene epoxidase / SQLE |