Antibodies

Jump to Filters
View as table Download
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322830

USD 380.00

4 Weeks

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
CD45 (PTPRC) Rabbit Polyclonal Antibody
TA351053

USD 380.00

In Stock

Rabbit Polyclonal Anti-PTPRC Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPRC
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA322829

USD 380.00

In Stock

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A
PPAP2A (PLPP1) Rabbit Polyclonal Antibody
TA346363

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
CD45 (PTPRC) Rabbit Polyclonal Antibody
TA327279

USD 365.00

3 Weeks

Rabbit anti-PTPRC Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PTPRC