Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471) |
Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201) |
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Rabbit Polyclonal Anti-GCNT3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
Rabbit Polyclonal Anti-GALNT6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the N terminal of human GALNT6. Synthetic peptide located within the following region: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP |
Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842) |
Germany
Japan
United Kingdom
China
