Germany
Japan
United Kingdom
China
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Goat Polyclonal Antibody against MAOB
| Applications | FC, IF, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Rabbit Polyclonal Anti-MAOB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Rabbit Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG |
Goat Polyclonal Anti-ALDH3A2 Antibody
| Applications | IHC |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1. |
Active filters
Reactivities
- Human
Applications
- IHC
Isotypes
- IgG
Families
- Transmembrane
Pathways
- Arginine and proline metabolism