HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit polyclonal HNF4A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Porcine, Bat, Equine, Hamster, Monkey, Rabbit |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1) |
Goat Polyclonal Antibody against HNF4A
Applications | IHC, PEP-ELISA, WB |
Reactivities | Human (Expected from sequence similarity: Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1. |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-HNF4A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV |
HNF 4 alpha (HNF4A) (+ gamma) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human HNF4α. |