Antibodies

Jump to Filters
View as table Download
AMH Rabbit Polyclonal Antibody
TA323643

USD 380.00

In Stock

Anti-AMH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone
AMH Rabbit Polyclonal Antibody
TA336233

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-AMH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
AMH (Center) Rabbit Polyclonal Antibody
AP50161PU-N

USD 580.00

2 Weeks

AMH (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 424-451 amino acids from the Central region of human AMH
AMH Rabbit Polyclonal Antibody
TA323644

USD 380.00

In Stock

Anti-AMH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone