Antibodies

View as table Download

Rabbit polyclonal Anti-SGK3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGK3 antibody: synthetic peptide directed towards the N terminal of human SGK3. Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH

Rabbit Polyclonal Anti-SGK3 Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Bat, Dog, Horse)
Conjugation Unconjugated
Immunogen SGK3 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit (100%); Dog, Bat, Elephant, Panda, Horse (94%); Mouse, Rat, Hamster, Pig, Lizard (88%); Bovine, Opossum (82%).