Rabbit Polyclonal Anti-LMX1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMX1A antibody: synthetic peptide directed towards the middle region of human LMX1A. Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL |
Rabbit Polyclonal Anti-LMX1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LMX1A antibody: synthetic peptide directed towards the middle region of human LMX1A. Synthetic peptide located within the following region: QNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTAL |
Germany
Japan
United Kingdom
China
