Antibodies

Jump to Filters
View as table Download
TFIIB (GTF2B) Rabbit Polyclonal Antibody
TA330172

USD 485.00

5 Days

Rabbit Polyclonal Anti-GTF2B Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK