Antibodies

Jump to Filters
View as table Download
SLC14A1 Rabbit Polyclonal Antibody
TA381548

USD 365.00

3 Weeks

SLC14A1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human SLC14A1 (NP_001295208.1).
SLC14A1 Rabbit Polyclonal Antibody
TA346523

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC14A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC14A1 antibody: synthetic peptide directed towards the C terminal of human SLC14A1. Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM